DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cip4 and LSB3

DIOPT Version :9

Sequence 1:NP_001097501.1 Gene:Cip4 / 38534 FlyBaseID:FBgn0035533 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_219497.4 Gene:LSB3 / 850580 SGDID:S000002968 Length:459 Species:Saccharomyces cerevisiae


Alignment Length:306 Identity:77/306 - (25%)
Similarity:111/306 - (36%) Gaps:95/306 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 FNIFGSNKNSLTADGQKED-------FSDLP------------PNQR--RKKLQAKIAELTQNIA 431
            ||...||....:.|..::|       ::|:|            ||.|  |::.|:.......:..
Yeast   216 FNYRPSNGGRGSFDDDEDDYYDDDDYYNDIPSSFSSTDASSTRPNTRSTRRRAQSGSRYTFDDDD 280

  Fly   432 QETKARDGLMKMKIVYEANSSLGNPMTVEGQLNESEHKLEKLKVDLKKYQGFLEKASQVPTATSS 496
            .:.....|       |..||.|. |....|    |..||:.                  |:..||
Yeast   281 DDDDYGTG-------YSRNSRLA-PTNSGG----SGGKLDD------------------PSGASS 315

  Fly   497 PQASRNQ---LQNGHRTSRHSNGSADDHHDDGDDQPDDAGSLSRSDSED-----NVAQIQNGHNN 553
            ..||..:   .|:..|:||  |..|||.:||.||  |......|.:..|     .|..:.|..:.
Yeast   316 YYASHRRSGTAQSRARSSR--NRWADDEYDDYDD--DYESGYRRGNGRDRTKDREVDDLSNRFSK 376

  Fly   554 NNNGSASPESGLGTSHTSLPGSGQGSANENAIGEDTYYETEVETLNPVGKCRALYPFEASSEGSI 618
            :...|||      |..||   .|:.:|           .|...|.:|  |..|||.|.....|.:
Yeast   377 SRISSAS------TPQTS---QGRFTA-----------PTSPSTSSP--KAVALYSFAGEESGDL 419

  Fly   619 PMSEGEELQVIE--IDQGDGWT-RVRRENNSNGWDEGFVPTSYIEI 661
            |..:|:.:.:::  ..|.|.|| ||      || .||..|.:|:|:
Yeast   420 PFRKGDVITILKKSDSQNDWWTGRV------NG-REGIFPANYVEL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cip4NP_001097501.1 F-BAR_CIP4-like 69..319 CDD:153337
HR1_CIP4-like 412..488 CDD:212009 15/77 (19%)
SH3_CIP4-like 603..661 CDD:212844 20/60 (33%)
LSB3NP_219497.4 SYLF 1..219 CDD:225482 2/2 (100%)
SH3_Ysc84p_like 404..458 CDD:212776 20/60 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.