DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cip4 and SRGAP2B

DIOPT Version :9

Sequence 1:NP_001097501.1 Gene:Cip4 / 38534 FlyBaseID:FBgn0035533 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001372155.1 Gene:SRGAP2B / 647135 HGNCID:35237 Length:489 Species:Homo sapiens


Alignment Length:413 Identity:85/413 - (20%)
Similarity:141/413 - (34%) Gaps:120/413 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ELWDQNENLAIHTNRGIDALDKFANFLRDRVAIETEYAGKLRRLVKNYQPK---KKEEEDNEFT- 130
            :|.:|.:.|.......:..|....:|.|.:..||.:|:..|.:|.:.:..|   .|:::.|.|| 
Human    27 QLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTCSTKDQQFNAFTV 91

  Fly   131 -----SVQA---FRNLLKEVGDLAGQREVVSESLQLQ----IIAGVT----LLSKTLREER---- 175
                 .|||   |..||.           ..||..|:    :::.|.    ||::..||.|    
Human    92 IMSPADVQAACDFPGLLS-----------TPESFPLRKDQNVLSPVNCWNLLLNQVKRESRDHTT 145

  Fly   176 ------------------------KKCLSDGATLQQNLTTQLSSLDRAKRNYEKAYRDSEKAVDS 216
                                    ||....|..||.:|...|:.|....:.|.....||..|...
Human   146 LSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK 210

  Fly   217 YKRA-----------------------DMDLNLSRAEVERYKNVMTSKIQQSDD----------- 247
            .|.|                       |...|: |.|.:..:.....||::..:           
Human   211 LKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANV-RIEEKHVRRSSVKKIEKMKEKRQAKYTENKL 274

  Fly   248 ----AKNEYANQLQKTNNLQQQHYSMLLPSVLNRLQEL--DEKRTRGFREFIVGAADVESSVAPI 306
                |:|||...|:.||....::|...|..::::..:|  .....|..|.|:....::|.|.   
Human   275 KAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAELNLEQSK--- 336

  Fly   307 IARCMEGIVKAGESINEKEDTFKVIERYQSGFTPPRDIPFE----DLSK--CDPDSVQ------- 358
             ...::.|..|.|:::...|..:::|.|.:.|.||....|:    |::.  |....||       
Human   337 -HEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQPVQSELLQRC 400

  Fly   359 ---DSHYSNSTSNHLTIRGTMSA 378
               .|..|.....:..::.||.|
Human   401 QQLQSRLSTLKIENEEVKKTMEA 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cip4NP_001097501.1 F-BAR_CIP4-like 69..319 CDD:153337 68/336 (20%)
HR1_CIP4-like 412..488 CDD:212009
SH3_CIP4-like 603..661 CDD:212844
SRGAP2BNP_001372155.1 BAR 26..319 CDD:416402 61/303 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.