DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cip4 and mlc-7

DIOPT Version :9

Sequence 1:NP_001097501.1 Gene:Cip4 / 38534 FlyBaseID:FBgn0035533 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001022669.1 Gene:mlc-7 / 176811 WormBaseID:WBGene00023451 Length:153 Species:Caenorhabditis elegans


Alignment Length:112 Identity:24/112 - (21%)
Similarity:43/112 - (38%) Gaps:30/112 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LAQITKKKT-------------VADLEAECVHSAIAFTCVRVCAKLLASGSSRSSSNNKLAESEN 57
            ||:::|.:|             ...:||.|..|    |.::....||:......:....|.|.::
 Worm    46 LAEVSKARTSGARITVEEFIPIYKKVEAACGRS----TTLKEFQTLLSHFDREGNGQIMLMELKS 106

  Fly    58 SAQNS---------NNMSWGTELWDQNENLAIHTNR----GIDALDK 91
            ..||.         :|:.:|.|:.|...|:....||    |::..:|
 Worm   107 MLQNGGEKMTNQEVDNLLFGVEVVDGRININNFLNRHLQMGLEESEK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cip4NP_001097501.1 F-BAR_CIP4-like 69..319 CDD:153337 7/27 (26%)
HR1_CIP4-like 412..488 CDD:212009
SH3_CIP4-like 603..661 CDD:212844
mlc-7NP_001022669.1 FRQ1 8..139 CDD:227455 20/96 (21%)
EFh 9..65 CDD:298682 4/18 (22%)
EF-hand_8 55..109 CDD:290545 9/57 (16%)
EFh 83..140 CDD:298682 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.