DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cip4 and SH3D19

DIOPT Version :9

Sequence 1:NP_001097501.1 Gene:Cip4 / 38534 FlyBaseID:FBgn0035533 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001365050.1 Gene:SH3D19 / 152503 HGNCID:30418 Length:1070 Species:Homo sapiens


Alignment Length:503 Identity:98/503 - (19%)
Similarity:157/503 - (31%) Gaps:192/503 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KKKEEEDNEFTSVQAFRNLLKEVGDLAGQREVVSESLQLQIIAGVTLLSKTLREERKK----CLS 180
            :::|:|:.|          |:|..:|.|||.....:|.....|.        |.||.|    ..|
Human     5 RRREDEEEE----------LRERRELGGQRRARGRALSGHSAAD--------RNERNKPEHRSSS 51

  Fly   181 DG------ATLQQNLTTQL-SSLDRAKRNYE-------------------------------KAY 207
            .|      |.::::..|.: |.|.|.:|..|                               .::
Human    52 QGPLSSIRAVIKRSSRTSIQSELHRDRRRPEITIVAAEPLRPASWFPGTPPPGLGFPTSSAAGSW 116

  Fly   208 RDSE----KAVDSYKRADMDLNLSRAEVERYKN-------VMTSKIQQSDDAKNEYANQLQKTNN 261
            |.:|    :...||::...::|..:.......|       .:||..|  .|...|..|.|.:|  
Human   117 RPNELVPAELPPSYEQVIKEINQVQVNTTNNNNAAATPRHTITSATQ--TDFSEEIDNDLPQT-- 177

  Fly   262 LQQQHYSMLLPSVLNRLQELDEKRTRGFREFIVGAADVESSVAPIIARCMEGIVKAGESINEKED 326
                     |.:.|..||...          .|.:.::.::|||:|      :....|..|..|:
Human   178 ---------LQAPLKPLQPFS----------AVSSGNLPTNVAPLI------VFDISEEPNCPEN 217

  Fly   327 TFKV-----IERYQSGFTP-PRDIPF--------------EDLSKCDPDSVQDSHYSNSTSNHLT 371
            ....     ..|.:|...| |||...              |:.|...|.|:.|:..::.:...:.
Human   218 PSATRCPVPKPRSKSNLRPIPRDSHIKEQSQQKISPAAVGEESSPGRPQSLLDNASTSDSQAVMN 282

  Fly   372 IRGT-MSANKLKKRVGIF----NI---------------------FGSNKNSLT-------ADGQ 403
            |..| .|.|.:..|:.:|    ||                     ..|.|.|:.       |.|:
Human   283 IMNTEQSQNSIVSRIKVFEGQTNIETSGLPKKPEITPRSLPPKPTVSSGKPSVAPKPAANRASGE 347

  Fly   404 -------------KEDFSDLPPNQRRKKLQAKIAELTQNIAQETKARDGLMKMKIVYEANSSLGN 455
                         ||..:..||.|....:.....||.:      |...||::         |:..
Human   348 WDSGTENRLKVTSKEGLTPYPPLQEAGSIPVTKPELPK------KPNPGLIR---------SVNP 397

  Fly   456 PMTVEGQLNESEHKLEKLKVD------LKKYQGFLEKASQVPTATSSP 497
            .:...|.|.||....:|:...      |||     ..:|:.||..|:|
Human   398 EIPGRGPLAESSDSGKKVPTPAPRPLLLKK-----SVSSENPTYPSAP 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cip4NP_001097501.1 F-BAR_CIP4-like 69..319 CDD:153337 47/251 (19%)
HR1_CIP4-like 412..488 CDD:212009 16/81 (20%)
SH3_CIP4-like 603..661 CDD:212844
SH3D19NP_001365050.1 PHA03247 <168..649 CDD:223021 64/320 (20%)
SH3_Eve1_1 699..748 CDD:212748
SH3_Eve1_2 779..830 CDD:212749
SH3_Eve1_3 855..905 CDD:212750
SH3_Eve1_4 945..994 CDD:212751
SH3_Eve1_5 1014..1063 CDD:212752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.