DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cip4 and LOC100537850

DIOPT Version :9

Sequence 1:NP_001097501.1 Gene:Cip4 / 38534 FlyBaseID:FBgn0035533 Length:665 Species:Drosophila melanogaster
Sequence 2:XP_003200461.2 Gene:LOC100537850 / 100537850 -ID:- Length:175 Species:Danio rerio


Alignment Length:141 Identity:31/141 - (21%)
Similarity:64/141 - (45%) Gaps:18/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DALDKFANFLRDRVAIETEYAGKLRRLVKNYQPK-----KKEEEDNEFTSVQ-AFRNLLKEVGDL 145
            |.|:....:.:.:..:|.:||..|::|...|..:     |.:::..::.:|. .:|..|:....:
Zfish    34 DLLEDMRTYSQKKATLERDYAQALQKLASQYLKRDWPGIKPDDQRTDYRNVYGVWRAYLEGTVQV 98

  Fly   146 AGQREVVSESLQLQIIAGVTLLSKTLR----EERKKCLSDGATLQQNLTTQLSSLDRAKRNY--- 203
            ...|..|.::.:.:|    |..:||:|    ::.|||:.....:|..|...:..|.::|:.|   
Zfish    99 TQSRLNVCDNYKNEI----TDPAKTVRLYKEQQLKKCIEQLGRIQTELQDSVKDLAKSKKKYFEL 159

  Fly   204 -EKAYRDSEKA 213
             :.|....|||
Zfish   160 EQMAQAVREKA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cip4NP_001097501.1 F-BAR_CIP4-like 69..319 CDD:153337 31/141 (22%)
HR1_CIP4-like 412..488 CDD:212009
SH3_CIP4-like 603..661 CDD:212844
LOC100537850XP_003200461.2 BAR 16..>175 CDD:299863 31/141 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D348563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.