DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15014 and thumpd1

DIOPT Version :9

Sequence 1:NP_647892.1 Gene:CG15014 / 38533 FlyBaseID:FBgn0035532 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_989059.1 Gene:thumpd1 / 394656 XenbaseID:XB-GENE-5742238 Length:290 Species:Xenopus tropicalis


Alignment Length:318 Identity:106/318 - (33%)
Similarity:159/318 - (50%) Gaps:38/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEPASKKSKMGKNVKFNNNKKKYFHAKRQTLQPGQRGFFATCNINEKACVRECYNLLNHYADILY 65
            |....:|.|.....:|..|.|:  ..:|..|:.|.:|...|||:||:.||.|.|:|||.|.|.:|
 Frog     1 MSTDGQKGKKRYKSQFCGNAKR--QKRRHELEVGMQGILITCNMNERKCVAEAYSLLNEYGDQMY 63

  Fly    66 GSEKPENEPEKKQPEEGAGGDAGEDDPKPAAGGTSDDDDDLEAAAAK----CREMLSQRKMRFQN 126
            |   ||...||             ||   ....:.::|||.|||..|    .|....:...|||:
 Frog    64 G---PEKLSEK-------------DD---GLSESEEEDDDAEAALKKEVDQIRTSTEKNLRRFQS 109

  Fly   127 VDTNTTNCVFIRTQLEDPVALGKHIINDIATTGKSMSRFVLRLVPIEVVCRANMPDIITAAGELF 191
            |::...|.:||||...:|..|..||:.|:.||.|..:|.:||::|:...|:|.:.|:...| |.|
 Frog   110 VESGANNVIFIRTLNVEPEKLVHHILKDVHTTKKKKTRVILRMLPVSGTCKAFLEDLKKYA-ETF 173

  Fly   192 DKHFLKEPT--SYGIIFNHRYNQQIKRDQIITQLAELVNSKNVGNKVDLKEAKKSIIVEVLRGWC 254
            ...:.|.|.  ::.|.:..|.|..:.||::|.:||.:|.|:|..|||||...:.::|||:::..|
 Frog   174 FAPWFKSPNKGTFQIAYKARNNNHMNRDEVIKELAGIVASQNPENKVDLSNPEYTVIVEIIKNVC 238

  Fly   255 LLSVIDNYLECKKFNLAELANPSDKKSSGEGDSKSETSEVANGNDKEQAESSEESKSN 312
            ..||:.:|...:|:||.|:.     |||.|...:..|.|     |||:.....:...|
 Frog   239 CFSVVKDYTVFRKYNLQEVI-----KSSKEEKPQQPTKE-----DKEENLKETQGTQN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15014NP_647892.1 THUMP_THUMPD1_like 123..260 CDD:212586 51/138 (37%)
thumpd1NP_989059.1 THUMP_THUMPD1_like 35..244 CDD:212586 82/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9591
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5878
Inparanoid 1 1.050 160 1.000 Inparanoid score I4144
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478461at2759
OrthoFinder 1 1.000 - - FOG0004286
OrthoInspector 1 1.000 - - oto103293
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4662
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.