DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2al1n and His2A:CG33829

DIOPT Version :9

Sequence 1:NP_001029272.1 Gene:H2al1n / 385328 MGIID:3643774 Length:109 Species:Mus musculus
Sequence 2:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster


Alignment Length:88 Identity:29/88 - (32%)
Similarity:52/88 - (59%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 RARSQRG--ELPLSLVDRFLREEIHSSRLSSSALPFLTSVLEYLTSNILELAGEVAHTTGRKCVA 75
            ::||.|.  :.|:..:.|.||:..::.|:.:.|..:|.:|:|||.:.:|||||..|....:..:.
  Fly    15 KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRII 79

Mouse    76 PEDVHLVVQNNEQLRQLFKSGGT 98
            |..:.|.::|:|:|.:|. ||.|
  Fly    80 PRHLQLAIRNDEELNKLL-SGVT 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2al1nNP_001029272.1 H2A 22..97 CDD:305064 24/74 (32%)
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 29/87 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.