DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and SLC25A33

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_115691.1 Gene:SLC25A33 / 84275 HGNCID:29681 Length:321 Species:Homo sapiens


Alignment Length:320 Identity:86/320 - (26%)
Similarity:141/320 - (44%) Gaps:53/320 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VHAVSGAAGGCIAMSTFYPLDTVRSRLQ------------------LEEAGDVRSTR------QV 57
            :|..:|..||.:......||:.:::|||                  :..||.||.|.      ||
Human    13 LHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQV 77

  Fly    58 IKEIVLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGII 122
            :|.|:..||.:||:|||||.|..:..|..|||..:...|...:|......:.:.....||.|.|.
Human    78 LKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIF
VPNSNIVHIFSAGSAAFIT 142

  Fly   123 NVLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPA 187
            |.| ..|.|:|.||:::......|.::     |.|:..:||.:.|||.|.:.|...|...:|...
Human   143 NSL-MNPIWMVKTRMQLEQKVRGSKQM-----NTLQCARYVYQTEGIRGFYRGLTASYAGISETI 201

  Fly   188 LQFMMYEMLKRNIMR------FTGGEMGSLSFFFI---GAIAKAFATVLTYPLQLVQTKQRHRSK 243
            :.|.:||.||:.:..      ..|.|..|.|||.:   .|::|..|:.:.||.::::|:.|....
Human   202 ICFAIYESLKKYLKE
APLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGT 266

  Fly   244 ESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
            :..|...|:.              .:.:.:|....:|||.|::::.:...|::...||.|
Human   267 KYKSFVQTAR--------------LVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYELI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 32/102 (31%)
Mito_carr 105..202 CDD:278578 28/96 (29%)
Mito_carr 214..303 CDD:278578 18/91 (20%)
SLC25A33NP_115691.1 Mito_carr 7..123 CDD:395101 34/109 (31%)
Solcar 1 9..118 33/104 (32%)
Mito_carr 125..216 CDD:395101 28/96 (29%)
Solcar 2 126..213 28/92 (30%)
Solcar 3 231..315 21/96 (22%)
Mito_carr 232..312 CDD:395101 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.