DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and PNC2

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_198104.1 Gene:PNC2 / 832812 AraportID:AT5G27520 Length:321 Species:Arabidopsis thaliana


Alignment Length:322 Identity:98/322 - (30%)
Similarity:166/322 - (51%) Gaps:42/322 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSYQNFVHAVSGAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQ------VIKEIVLGEGFQS 69
            |..::...|.|||.|..::.:..|||||.:|:.|.|..  ||..::      |..|.:......|
plant     5 LDLESISEATSGAIGSLLSTTILYPLDTCKSKFQAEIR--VRGQQKYRYLSDVFWEAISSGNVLS 67

  Fly    70 LYRGLGPV-LQSLCISNFVYFYTFHALKAVASGGSPSQHSALK-DLLLGSIAGIINVLTTTPFWV 132
            ||:|||.. |||. ||:|:|||::...|.:.|....|:....| :||:.:.||....:.|.|...
plant    68 LYQGLGTKNLQSF-ISSFIYFYSYSYFKRLHSQRIGSKSIGTKANLLIAAAAGACTSVLTQPLDT 131

  Fly   133 VNTRLRMRNVAGTSDEVNKH---YKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPALQFMMYE 194
            .::|::       :.|..|.   :|.|.:|        .....:.|...||:|.||||:|:.:::
plant   132 ASSRMQ-------TSEFGKSKGLWKTLTDG--------SWGNAFDGLGISLLLTSNPAIQYTVFD 181

  Fly   195 MLKRNIMRFTGGE---------MGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPS 250
            .||:|::.....:         :.:...|.:||::|:.|||:|||  .::.|...::.: |||.:
plant   182 QLKQNLLEKGKAKSNKDSSPVVLSAFMAFVLGAVSKSAATVITYP--AIRCKVMIQAAD-DSKEN 243

  Fly   251 TSAGSTPRTESTLE-LMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKIAGTVGMLL 311
            .:.....|...|:. ::.:|.:.:||.|.|:||:|:||:|||::||:.|..|||..|..:|:
plant   244 EAKKPRKRIRKTIPGVVYAIWKKEGILGFFKGLQAQILKTVLSSALLLMIKEKITATTWILI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 32/87 (37%)
Mito_carr 105..202 CDD:278578 26/100 (26%)
Mito_carr 214..303 CDD:278578 33/89 (37%)
PNC2NP_198104.1 Mito_carr 6..96 CDD:395101 33/92 (36%)
Mito_carr 110..191 CDD:395101 24/95 (25%)
Mito_carr 204..297 CDD:395101 33/95 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.