DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and NDT1

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_566102.1 Gene:NDT1 / 819362 AraportID:AT2G47490 Length:312 Species:Arabidopsis thaliana


Alignment Length:304 Identity:91/304 - (29%)
Similarity:151/304 - (49%) Gaps:41/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HAVSGAAGGCIAMSTFYPLDTVRSRLQ---LEEAGD--------VRSTRQVIKEIVLGEGFQSLY 71
            :|.:|||.|.:|.:...|||.:::|.|   |.:.||        |.|..|:.|.    ||.:.||
plant    16 NAAAGAAAGVVAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKR----EGMRGLY 76

  Fly    72 RGLGPVLQSLCISNF-VYFYTFHALKAVASGGSPSQH--SALKDLLLGSIAGIINVLTTTPFWVV 133
            |||.|.:.:| :||: :||..:..||:....   :.|  |...::|..|.||....:.|.|.|||
plant    77 RGLSPTVMAL-LSNWAIYFTMYDQLKSFLCS---NDHKLSVGANVLAASGAGAATTIATNPLWVV 137

  Fly   134 NTRLRMRNV-AGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPALQFMMYEMLK 197
            .|||:.:.: .|...     ||:....|:.:|.:|||.||:||.:|:|..:|:.|:||..|||:|
plant   138 KTRLQTQGMRVGIVP-----YKSTFSALRRIAYEEGIRGLYSGLVPALAGISHVAIQFPTYEMIK 197

  Fly   198 RNIMRFTGGEMGSLS---FFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRT 259
            ..:.:.....:.:|:   .....:|||.||:.||||.::|:.:.:.:...|:.          |.
plant   198 VYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHSEK----------RY 252

  Fly   260 ESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
            ....:.:..:.:..|..|.:||....:|:|...|.:.|.::|.:
plant   253 SGVRDCIKKVFEKDGFPGFYRGCATNLLRTTPAAVITFTSFEMV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 31/89 (35%)
Mito_carr 105..202 CDD:278578 36/99 (36%)
Mito_carr 214..303 CDD:278578 21/88 (24%)
NDT1NP_566102.1 Mito_carr <29..104 CDD:395101 27/79 (34%)
Mito_carr <129..204 CDD:395101 30/79 (38%)
Mito_carr 218..303 CDD:395101 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.