DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and Slc25a33

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_081736.2 Gene:Slc25a33 / 70556 MGIID:1917806 Length:320 Species:Mus musculus


Alignment Length:326 Identity:90/326 - (27%)
Similarity:145/326 - (44%) Gaps:55/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VHAVSGAAGGCIAMSTFYPLDTVRSRLQ------------------LEEAGDVRSTR------QV 57
            :|..:|..||.:......||:.:::|||                  :..||.||.|.      ||
Mouse    13 LHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLLQV 77

  Fly    58 IKEIVLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGII 122
            :|.|:..||.:||:|||||.|..:..|..|||..:...|...:|......:.:..|..||.|.:.
Mouse    78 LKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNTVHILSAGSAAFVT 142

  Fly   123 NVLTTTPFWVVNTRLRM-RNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNP 186
            |.| ..|.|:|.||::: |.|.|...      .|.|:..:.|.:.||:.|.:.|...|...:|..
Mouse   143 NTL-MNPIWMVKTRMQLERKVRGCKQ------MNTLQCARRVYQTEGVRGFYRGLTASYAGISET 200

  Fly   187 ALQFMMYEMLKR-----NIMRFTGGEMGSLSFFF----IGAIAKAFATVLTYPLQLVQTKQRHRS 242
            .:.|.:||.||:     .|:..|.|...|.|.||    ..|::|..|:.:.||.::::|    |.
Mouse   201 IICFAIYESLKKCLKDAPIVSSTDGAEKSSSGFFGLMAAAAVSKGCASCIAYPHEVIRT----RL 261

  Fly   243 KESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKIAGTV 307
            :|..||          ..|.::....:.:.:|....:|||.|::::.:...|::...||.|...:
Mouse   262 REEGSK----------YRSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYEFIVYLL 316

  Fly   308 G 308
            |
Mouse   317 G 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 32/102 (31%)
Mito_carr 105..202 CDD:278578 29/102 (28%)
Mito_carr 214..303 CDD:278578 21/92 (23%)
Slc25a33NP_081736.2 PTZ00169 6..316 CDD:240302 89/323 (28%)
Mito_carr 7..123 CDD:278578 34/109 (31%)
Solcar 1 9..118 33/104 (32%)
Mito_carr 125..212 CDD:278578 27/93 (29%)
Solcar 2 126..213 28/93 (30%)
Mito_carr 229..319 CDD:278578 25/103 (24%)
Solcar 3 231..315 23/97 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.