DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and slc25a17

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001004781.1 Gene:slc25a17 / 448001 XenbaseID:XB-GENE-952229 Length:310 Species:Xenopus tropicalis


Alignment Length:303 Identity:149/303 - (49%)
Similarity:200/303 - (66%) Gaps:14/303 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKLSQVLSYQNFVHAVSGAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQVIKEIVLGEGFQS 69
            |.|..|.:|::.|||||||.|...||:.||||||.|.|||:::....|||..|:.||:..||..:
 Frog     6 SALLSVFTYESLVHAVSGAVGSVAAMTLFYPLDTARLRLQVDDNRKSRSTPAVLLEIMREEGVLA 70

  Fly    70 LYRGLGPVLQSLCISNFVYFYTFHALKAVASGGS-PSQHSALKDLLLGSIAGIINVLTTTPFWVV 133
            .|||..||:.|||.|||||||||.:|||::..|| |:..   |||.:|.|||::|||.|||.|||
 Frog    71 PYRGWFPVISSLCCSNFVYFYTFSSLKALSVKGSVPTTG---KDLTIGFIAGVVNVLITTPLWVV 132

  Fly   134 NTRLRMRNVAGTSDE-VNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPALQFMMYEMLK 197
            ||||:::.....:|: |...|..:.:..:.:..:||:..||:||.|||:||.|||:|||.||.||
 Frog   133 NTRLKLQGAKFRNDDIVPTTYTGIFDAFQRILREEGVMALWNGTFPSLLLVFNPAIQFMFYEALK 197

  Fly   198 RNIMRFTGG--EMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTE 260
            |.:::   |  |:.::..|.|||||||.||.||||:|.||:..|. .:|..:....:.||   ..
 Frog   198 RQLLK---GQPELTAMEVFVIGAIAKAIATALTYPMQTVQSVLRF-GQEKLNPEKRALGS---LR 255

  Fly   261 STLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
            |.|.|:...::..||.||::|||||:|||||||||||:.|||:
 Frog   256 SVLYLLQQRVKRWGILGLYKGLEAKLLQTVLTAALMFLVYEKL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 45/80 (56%)
Mito_carr 105..202 CDD:278578 45/97 (46%)
Mito_carr 214..303 CDD:278578 46/88 (52%)
slc25a17NP_001004781.1 Mito_carr 12..99 CDD:278578 48/86 (56%)
Mito_carr 104..202 CDD:278578 47/100 (47%)
Mito_carr 206..298 CDD:332982 47/95 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4637
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1186395at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45939
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.