DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment PMP34 and allc

DIOPT Version :9

Sequence 1:	NP_001246615.1	Gene:	PMP34 / 38532	FlyBaseID:	FBgn0052250	Length:	314	Species:	Drosophila melanogaster
Sequence 2:	NP_001002716.1	Gene:	allc / 436989	ZFINID:	ZDB-GENE-040718-471	Length:	395	Species:	Danio rerio

Alignment Length:	113	Identity:	26/113 - (23%)
Similarity:	44/113 - (38%)	Gaps:	34/113 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    78 LQSLCISNFVYFYTFHALKAVASG--GSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMR 140
            :|:.|:......    ||:...:|  .||||..|:..|...|...::.|          |:|:
Zfish   111 IQATCLDQMPSI----ALEGDRTGMAASPSQFEAVAQLNSDSWKEVVPV----------TKLK-- 159

  Fly   141 NVAGTSDEVNKH----YKNLLEGLKY-VAEKEGIAGL---------WS 174
              ||.||..:.:    |.:.:..::: :....|||.|         ||
Zfish   160 --AGYSDTCHNYLSVSYPHRVTHIRFNIYPDGGIARLKVYGIGKKDWS 205

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
PMP34	NP_001246615.1	Mito_carr	15..96	CDD:278578	3/17 (18%)
		Mito_carr	105..202	CDD:278578	19/84 (23%)
		Mito_carr	214..303	CDD:278578
allc	NP_001002716.1	allantoicase	18..384	CDD:274363	26/113 (23%)
		Allantoicase	28..198	CDD:281549	24/104 (23%)
		Allantoicase	221..383	CDD:281549
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4266
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900