DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and slc25a36a

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001002667.1 Gene:slc25a36a / 436940 ZFINID:ZDB-GENE-040718-415 Length:311 Species:Danio rerio


Alignment Length:324 Identity:80/324 - (24%)
Similarity:137/324 - (42%) Gaps:63/324 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VHAVSGAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQV-------------------IKEIV 62
            ||..:|..||.:......||:.|::|||........|..|:                   :|.|:
Zfish     8 VHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTFYISEVQLSTVNGASVARMAPPGPLHCLKLIL 72

  Fly    63 LGEGFQSLYRGLGPVLQSLCISNFVYFYTF----HALKAVASGGSPSQHSALKDLLLGSIAGIIN 123
            ..||.:||:|||||.|..:..|..:||..:    ..|..|....|...|     :|...:||...
Zfish    73 EKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSTSKEKLNNVFDPDSTQVH-----MLSAGLAGFTA 132

  Fly   124 VLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNL--LEGLKYVAEKEGIAGLWSGTIPSLMLVSNP 186
            :..|.|.|::.|||::       |..|:..:.:  .|.::.|.:.:|:.|.:.|...|...:|..
Zfish   133 ITATNPIWLIKTRLQL-------DARNRGERRMSAFECVRRVYQSDGLRGFYRGMSASYAGISET 190

  Fly   187 ALQFMMYEMLKRNIMRFTGG-------EMGSLSFFFIG-----AIAKAFATVLTYPLQLVQTKQR 239
            .:.|::||.:||.::.....       |....:..|:|     |.:|..||.:.||.::::|   
Zfish   191 VIHFVIYESIKRKLIEHKANSNMDDEDESVKDASDFVGMMLAAATSKTCATSIAYPHEVIRT--- 252

  Fly   240 HRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
             |.:|..||          ..|..:.:..:.:.:|.|.|:|||...:::.:...|:|...||.:
Zfish   253 -RLREEGSK----------YRSFFQTLNMVFREEGYRALYRGLTTHLVRQIPNTAIMMCTYELV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 28/101 (28%)
Mito_carr 105..202 CDD:278578 24/98 (24%)
Mito_carr 214..303 CDD:278578 24/93 (26%)
slc25a36aNP_001002667.1 Mito_carr 2..113 CDD:278578 29/104 (28%)
Solcar 1 4..108 28/99 (28%)
PTZ00169 5..290 CDD:240302 76/307 (25%)
Mito_carr 114..208 CDD:278578 25/105 (24%)
Solcar 2 116..203 24/98 (24%)
Solcar 3 224..308 24/96 (25%)
Mito_carr 226..311 CDD:278578 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.