DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and CG7943

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:306 Identity:67/306 - (21%)
Similarity:111/306 - (36%) Gaps:72/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AGGC----IAMSTFYPLDTVRSRLQLEEAGDVRSTRQVIKEIVLGEGFQSLYRGLGPVLQSLCIS 84
            |.||    :.::..||:..:..|..|.......:..|:..|   |.||  ||||:.|.|....||
  Fly    58 ACGCGAAFVNIAVTYPIYKMIFRQMLHGVPITSAFAQLRHE---GLGF--LYRGMLPPLAQKTIS 117

  Fly    85 NFVYF------------------YTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFW 131
            ..:.|                  |....|.||.:|.:.|       :||             ||.
  Fly   118 LSIMFGVFDGTRRYLVEDY
RLNDYGAKVLAAVVAGSAES-------ILL-------------PFE 162

  Fly   132 VVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLML--VSNPALQFMMYE 194
            .|.|.|       ...:.::|:.|.....:||....|...|:.|..|....  :|| ||.|::.|
  Fly   163 RVQTLL-------ADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSN-ALFFVLRE 219

  Fly   195 MLKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRT 259
            .....:.:.......::..|..||:..|..:.:.|||.::             |.|..:....|:
  Fly   220 EASVRLPKRK
SVSTRTVQEFIAGAVIGASISTIFYPLNVI-------------KVSLQSEMGQRS 271

  Fly   260 ESTLEL--MISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
            |.:.:.  .|.:.:.:.|...:||......::.::..:|..|||.:
  Fly   272 EGSWQACKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 22/93 (24%)
Mito_carr 105..202 CDD:278578 22/98 (22%)
Mito_carr 214..303 CDD:278578 19/90 (21%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 21/82 (26%)
Mito_carr 141..229 CDD:278578 27/115 (23%)
Mito_carr 235..322 CDD:278578 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.