DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and mfrn

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:296 Identity:66/296 - (22%)
Similarity:125/296 - (42%) Gaps:46/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VHAVSGAAGGCIAMSTFYPLDTVRSRLQ-LEEAGDVRSTRQVIKEIVLGEGFQSLYRGLGPVLQS 80
            |:..:||..|.:.....||||:|::|:| |.......:....::.::..||.....||...|:..
  Fly    16 VNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGLLRPIRGASAVVLG 80

  Fly    81 LCISNFVYFYTFHALKAVASGGSPSQHSALKDL---LLGSIAGIINVLTTTPFWVVNTRLRMRNV 142
            ...::.:||..:...|.:.     ::.:::::|   :.|::|.:|:...::|..|:..|::|   
  Fly    81 AGPAHSLYFAAYEMTKELT-----AKFTSVRNLNYVISGAVATLIHDAISSPTDVIKQRMQM--- 137

  Fly   143 AGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWS--GTIPSLMLVSN---PALQFMMYEML--KRNI 200
                  .|..|.:::..::.:.::||....:.  ||    .||.|   ..:.|..||..  |.|:
  Fly   138 ------YNSPYTSVVSCVRDIYKREGFKAFYRAYGT----QLVMNLPYQTIHFTTYEFFQNKMNL 192

  Fly   201 MRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLEL 265
            .|    :.........||.|.|.|..:|.||.:::|             ..:...|..|...:|.
  Fly   193 ER----KYNPPVHMAAGAAAGACAAAVTTPLDVIKT-------------LLNTQETGLTRGMIEA 240

  Fly   266 MISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYE 301
            ...|....|..|.|||..|::|.::...|:.:..||
  Fly   241 SRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 19/79 (24%)
Mito_carr 105..202 CDD:278578 22/106 (21%)
Mito_carr 214..303 CDD:278578 23/88 (26%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 20/81 (25%)
PTZ00168 17..280 CDD:185494 65/295 (22%)
Mito_carr 107..190 CDD:278578 20/95 (21%)
Mito_carr <215..282 CDD:278578 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.