DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and CG4743

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:313 Identity:76/313 - (24%)
Similarity:126/313 - (40%) Gaps:48/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLSQVLSYQNFVHA-VSGAAGGCIAMSTFYPLDTVRSRLQLE----EAGDVRSTRQVIKEIVLGE 65
            |:.:.::...|.|| |:|...|.:.....:|:|||::|||.|    .||                
  Fly    17 KMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSELGFWRAG---------------- 65

  Fly    66 GFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPF 130
            ||:.:|:||.|.......:..::|.|:...|...|..:.::.|....:...|.|.::..|...| 
  Fly    66 GFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVP- 129

  Fly   131 WVVNTRLRMRNVAGTSDE----VNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLML-VSNPALQF 190
             |...:.|.:.:.|....    :.:.|:.  ||||        .||:.|...::|. :....:||
  Fly   130 -VEIAKQRSQTLQGNKQSGLQILLRAYRT--EGLK--------RGLYRGFGSTIMREIPFSLIQF 183

  Fly   191 MMYEMLKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGS 255
            .::|..|......||.:....|....||:|...:..||.||.:|:|:.....:|          |
  Fly   184 PLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERE----------S 238

  Fly   256 TPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKIAGTVG 308
            ..|..|...::..|...:|..|||.|...::|...|..|..|..|:.....:|
  Fly   239 LNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTRILG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/85 (28%)
Mito_carr 105..202 CDD:278578 21/101 (21%)
Mito_carr 214..303 CDD:278578 24/88 (27%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 25/91 (27%)
PTZ00168 25..281 CDD:185494 72/293 (25%)
Mito_carr 199..291 CDD:278578 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.