DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and DPCoAC

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:320 Identity:75/320 - (23%)
Similarity:132/320 - (41%) Gaps:49/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VAP--SKLSQVLSYQNFVHAVSGAAGGCIAMSTFYPLDTVRSRLQLEEAGDV----RSTRQVIKE 60
            |.|  .|:.||:     :..:||||.|.:|.:...|||  |:::..:...||    |::.:.::.
  Fly    62 VTPMRQKIDQVV-----ISLISGAAAGALAKTVIAPLD--RTKINFQIRNDVPFSFRASLRYLQN 119

  Fly    61 IVLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVL 125
            ....||..:|:||....:..:.....:.|......:.:........::..:..|.||:|||.:..
  Fly   120 TYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQS 184

  Fly   126 TTTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEG----IAGLWS---GTIPSLMLV 183
            .|.|..:...|:      ..:|... .|:.|.:....:..:||    ..|.|:   |.||     
  Fly   185 LTYPLDLARARM------AVTDRYT-GYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIP----- 237

  Fly   184 SNPALQFMMYEMLKRNIMRFTGGE----MGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKE 244
             .....|..||.|||......|..    :.||:|   ||.|.|.....:|||.:|      |.:.
  Fly   238 -YAGTSFFTYETLKREYYEVVGNNKPNTLVSLAF---GAAAGAAGQTASYPLDIV------RRRM 292

  Fly   245 SDSKPSTSAGSTPRTESTLELMISILQHQGIR-GLFRGLEAKILQTVLTAALMFMAYEKI 303
            ...:.:|:.|.  |..:.||.::.|.:.:|:: |.::||....::..:...:.|..|:.|
  Fly   293 QTMRVNTAGGD--RYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 19/84 (23%)
Mito_carr 105..202 CDD:278578 25/103 (24%)
Mito_carr 214..303 CDD:278578 21/89 (24%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 20/93 (22%)
Mito_carr 169..251 CDD:278578 23/94 (24%)
Mito_carr 279..356 CDD:278578 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.