DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and GC1

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:193 Identity:45/193 - (23%)
Similarity:98/193 - (50%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIA 170
            |.:.|..::.|.|||||.|....|..:|.|||:.:.:....:.:   |.::.:..:...:.||..
  Fly    18 QFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERM---YNSMFDCFRKTYKAEGYF 79

  Fly   171 GLWSGTIPSLMLVS-NPALQFMMYEMLKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLV 234
            |::.|:..:::|:: ..|::....:.. |:.:....|::...|....|.:|.||..::|.|::|:
  Fly    80 GMYRGSGVNILLITPEKAIKLTANDYF-RHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELL 143

  Fly   235 QTKQRHRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMF 297
            :.:.:...:.:.:  :..||.|....|..:|...:::.:||.||::|:.|..|:.|..:.:.|
  Fly   144 KIQMQDAGRVAAA--AKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578
Mito_carr 105..202 CDD:278578 22/96 (23%)
Mito_carr 214..303 CDD:278578 21/84 (25%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 14/80 (18%)
Mito_carr 115..213 CDD:278578 23/92 (25%)
Mito_carr 226..307 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.