DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and CG2616

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:338 Identity:82/338 - (24%)
Similarity:143/338 - (42%) Gaps:73/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VSGAAGGCIAMSTFYPLDTVRSRLQLEEA-----------------------GDVRSTRQ----- 56
            :|...|..|......|||.:::|:|.:::                       .::.|.||     
  Fly    95 ISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFS 159

  Fly    57 ----VIKEIVLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKA-----VASGGSPSQ---HSA 109
                .:.:|...||..:|:.||||.|.|...|..:||..:...||     ..|..:.||   |..
  Fly   160 SSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYL
QIYESHYNKSQEPRHLE 224

  Fly   110 LKD----------LLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVA 164
            ::|          ::.|..|.|..|...:|..:|.|:::.:         .:.|..:|:.::.|.
  Fly   225 IRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ---------RQTYAQMLQFVRSVV 280

  Fly   165 EKEGIAGLWSGTIPSLML-VSNPALQFMMYEMLKRNIMRFTGGEMGSLSFFFI-GAIAKAFATVL 227
            ..:|:.|||.|..|:::. |....:.:.:||.||:|:..   |...|.|..|: |.:|...|.::
  Fly   281 ALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGH---GSQPSFSLSFLAGVMAGTVAAIV 342

  Fly   228 TYPLQLVQTKQRHRSKE----SDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQ 288
            |.|..:|:|.::....|    :|| |:...|.    :||...:..|.:..|:||||.|...::|:
  Fly   343 TTPFDVVKTHEQIEFGERVIFTDS-PARDFGK----KSTFSRLTGIYRTHGVRGLFAGCGPRLLK 402

  Fly   289 TVLTAALMFMAYE 301
            .....|:|...:|
  Fly   403 VAPACAIMISTFE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/107 (22%)
Mito_carr 105..202 CDD:278578 26/110 (24%)
Mito_carr 214..303 CDD:278578 26/93 (28%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 26/111 (23%)
Mito_carr 230..321 CDD:278578 22/102 (22%)
Mito_carr 321..425 CDD:278578 28/100 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.