DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and slc25a33

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_998322.1 Gene:slc25a33 / 406436 ZFINID:ZDB-GENE-040426-2183 Length:314 Species:Danio rerio


Alignment Length:324 Identity:84/324 - (25%)
Similarity:139/324 - (42%) Gaps:63/324 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VHAVSGAAGGCIAMSTFYPLDTVRSRLQ----------------LEEAGDVR------STRQVIK 59
            :|..:|..||.:......||:.:::|||                |..||.:|      ...||::
Zfish     8 LHLFAGGCGGTVGAIMTCPLEVLKTRLQSSGLTLRPVFQVQLGTLNGAGVIRPGSVTPGLLQVLR 72

  Fly    60 EIVLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASG------GSPSQHSALKDLLLGSI 118
            .|:..||.:||:|||||.|..:..|..:||..:...|...:|      |.....||      |..
Zfish    73 SILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSKSKETFNGIFVPNSGVVHMSSA------GFA 131

  Fly   119 AGIINVLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLV 183
            |.|.|.| ..|.|:|.||:::...|....::     |.|:..:||.:.||:.|.:.|...|...:
Zfish   132 AFITNSL-MNPIWMVKTRMQLEKKARGEKKM-----NALQCARYVYKTEGMRGFYRGLTASYAGI 190

  Fly   184 SNPALQFMMYEMLKRNI--MRFT-------GGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQR 239
            |...:.|::||.||:.:  .|||       .|....|...|..|.||..|:.:.||.::::|:.|
Zfish   191 SETMICFLIYETLKKYLAQSRFTTPDTDNDKGASDFLGLMFAAAFAKGCASCIAYPHEVIRTRLR 255

  Fly   240 HRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
            ..            ||..:.......::::  .:|....:|||..::::.:...|::...||.|
Zfish   256 EE------------GSKYKYFFQTARLVAV--EEGYAAFYRGLIPQLIRQIPNTAIVLSTYELI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 29/100 (29%)
Mito_carr 105..202 CDD:278578 28/98 (29%)
Mito_carr 214..303 CDD:278578 18/88 (20%)
slc25a33NP_998322.1 PTZ00169 4..309 CDD:240302 84/324 (26%)
Solcar 1 4..111 30/102 (29%)
Mito_carr 6..116 CDD:278578 31/107 (29%)
Solcar 2 119..206 29/98 (30%)
Mito_carr 122..207 CDD:278578 28/96 (29%)
Solcar 3 224..308 20/96 (21%)
Mito_carr 226..309 CDD:278578 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.