DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and Dic4

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:288 Identity:63/288 - (21%)
Similarity:128/288 - (44%) Gaps:33/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQVIKEIVLGEGFQSLYRGL-GPVLQSLCISN 85
            |.|..|:|.:. .|:|.|::.:|::.  ..||....:|.|...:|:...|.|. ..:|:.:..:|
  Fly    27 GFASMCVAFAV-APIDIVKTHMQIQR--QKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMTSTN 88

  Fly    86 --FVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSDE 148
              |:.:.|...::.|      .:.|.|..::||.:||........|..::|  :||:........
  Fly    89 IHFIVYDTGKKMEYV------DRDSYLGKIILGCVAGACGSAFGIPTDLIN--VRMQTDMKEPPY 145

  Fly   149 VNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVS-NPALQFMMYEMLKRNIMRFTGGEMGSLS 212
            ..::||::.:||..:.::||...|:.|...::...| :...|...|:::|..:.:......|...
  Fly   146 KRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLPL 210

  Fly   213 FFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRT--ESTLELMISILQHQGI 275
            .|.........::.:|:||.:|:|..      .:|:|...     ||  ::::.:|     ..|:
  Fly   211 HFLTSLGTSIISSAITHPLDVVRTIM------MNSRPGEF-----RTVFQASVHMM-----RFGV 259

  Fly   276 RGLFRGLEAKILQTVLTAALMFMAYEKI 303
            .|.:||....|::......|:|:.||::
  Fly   260 MGPYRGFVPTIVRKAPATTLLFVLYEQL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 19/76 (25%)
Mito_carr 105..202 CDD:278578 22/97 (23%)
Mito_carr 214..303 CDD:278578 20/90 (22%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 63/288 (22%)
Mito_carr 26..100 CDD:278578 19/75 (25%)
Mito_carr 104..201 CDD:278578 22/98 (22%)
Mito_carr 211..292 CDD:278578 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.