DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and Bmcp

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:316 Identity:70/316 - (22%)
Similarity:140/316 - (44%) Gaps:35/316 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSQVLSYQNFVHAVSGAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQV--------IKEIVL 63
            :.:|..::.||:  .|.|.......|| |:||.::|||::.....:|..|:        ..:|..
  Fly     1 MGEVKDWRPFVY--GGVASITAEFGTF-PIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISR 62

  Fly    64 GEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVAS--------GGSPSQHSALKDLLLGSIAG 120
            .||.::||.|:.|.:........:.|.|::.||.:|:        .||....|   ::|..:.||
  Fly    63 EEGLRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWS---NILCAAAAG 124

  Fly   121 IINVLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLM-LVS 184
            .|:.....|..|:..|:::..        ...:|.||.....:.:.||:.|||.|..|:.. .|.
  Fly   125 AISSAIANPTDVLKVRMQVHG--------KGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVV 181

  Fly   185 NPALQFMMYEMLKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTK-QRHRSKESDSK 248
            ..:::..:|:..|..:|...|..:|  :.|....||...:.:.:.|:.:::|: ...|.......
  Fly   182 IASVELPVYDFCKLQLMNAFGDHVG--NHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMN 244

  Fly   249 PSTSAGSTPRTES-TLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
            ...:|.:||:..| :|:..:..::::|:..|::|.....::......:.|:.||::
  Fly   245 GVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 23/88 (26%)
Mito_carr 105..202 CDD:278578 21/97 (22%)
Mito_carr 214..303 CDD:278578 17/90 (19%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 25/92 (27%)
Mito_carr <132..199 CDD:278578 16/74 (22%)
Mito_carr 204..303 CDD:278578 18/99 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.