DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and sea

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:293 Identity:77/293 - (26%)
Similarity:133/293 - (45%) Gaps:35/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VSGAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQV---IKEIVLGEGFQSLYRGLGPVLQSL 81
            |:|...|.|.:...||.:.|:::|||:|.|..:....:   :|:.|...||..|||||..::...
  Fly    38 VAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGS 102

  Fly    82 CISNFVYFYTFHALK--AVASGGSPSQHSALKDLLLGSIAGIIN-VLTTTPFWVVNTRLRMRNVA 143
            ...:...|..|..||  ||.|.|   |.|....||.|..||:.. ::..||...:..:......:
  Fly   103 IPKSAARFGAFEFLKSNAVDSRG---QLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFINDQRS 164

  Fly   144 GTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLV-SNPALQFMMYEMLKRNIMRFTGGE 207
            |     |..::....|:..:.:.|||:|::.|..|:::.. ||.|::|.:.|.||.   .:.|.:
  Fly   165 G-----NPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKD---LYKGDD 221

  Fly   208 ----MGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMIS 268
                :..|.....||||.|.:.....||.:|:|  |.:..|:.           :.::|....:.
  Fly   222 HTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKT--RMQGLEAS-----------KYKNTAHCAVE 273

  Fly   269 ILQHQGIRGLFRGLEAKILQTVLTAALMFMAYE 301
            ||:::|....::|...::.:..|..|:.||.|:
  Fly   274 ILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 23/78 (29%)
Mito_carr 105..202 CDD:278578 25/98 (26%)
Mito_carr 214..303 CDD:278578 21/88 (24%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 74/287 (26%)
Mito_carr 34..117 CDD:278578 23/78 (29%)
Mito_carr 125..220 CDD:278578 26/105 (25%)
Mito_carr 235..314 CDD:278578 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442014
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.