DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and CG18327

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:307 Identity:62/307 - (20%)
Similarity:140/307 - (45%) Gaps:50/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GGCIAMST---FYPLDTVRSRLQLE--------EAGDVRSTRQVIKEIVLGEGFQSLYRGLGPVL 78
            ||..||..   ..|::.:::|:||:        .|...:|..|....:...:|...|.:||.|  
  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAP-- 71

  Fly    79 QSLC----ISNF-VYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLR 138
             :||    |::| :..|| ||::......:..:.|..|.:..|::.|::.....:||:::.|:|:
  Fly    72 -ALCFQFVINSFRLSIYT-HAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQ 134

  Fly   139 MRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVS-NPALQFMMY----EMLKR 198
            .:.....:......:.::.:.::.:..|.|:.|||.|::.::...: ..|:|..::    .:||.
  Fly   135 AQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKE 199

  Fly   199 N-------IMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGST 256
            |       |:.|..           |..|.:|.::...||.:|.|:..::..::..:.....|  
  Fly   200 NGVVTHPTILSFCS-----------GLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRG-- 251

  Fly   257 PRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
                 .|:.:::||:.:|:.||::|.....|::...:.|:.:.::::
  Fly   252 -----WLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/86 (28%)
Mito_carr 105..202 CDD:278578 20/108 (19%)
Mito_carr 214..303 CDD:278578 17/88 (19%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 20/80 (25%)
PTZ00169 5..293 CDD:240302 62/305 (20%)
Mito_carr 101..201 CDD:278578 18/99 (18%)
Mito_carr 204..296 CDD:278578 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.