DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and CG4995

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:298 Identity:68/298 - (22%)
Similarity:130/298 - (43%) Gaps:33/298 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SQVLSYQNFVHAVSGAAGGCIAMSTFYPLDTVRSRLQLEEAGD--VRSTRQVIKEIVLGEGFQSL 70
            |:..|.:..|..|:|..||...:...:|.|||:..||.::..:  .:.|....:.||..:.|..|
  Fly    33 SETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGL 97

  Fly    71 YRGLGPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNT 135
            |||:...:..:.:.|.:.|..:..::.:    |...:|.......|||||:.......|..:..|
  Fly    98 YRGISSPMGGIGLVNAIVFGVYGNVQRL----SNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKT 158

  Fly   136 RLRMRNVAGTSDEVNKHYK--NLLEGLKYVAEKEGIAGLWSG-TIPSLMLVSNPALQFMMYEMLK 197
            ||::      |.:|:...|  ..:..|||:.:.|||.|.:.| |...|..:...|..|:.:|.|.
  Fly   159 RLQL------STQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLM 217

  Fly   198 RNIMRFTGGEMGSLSF-FFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTES 261
            |.:      |...::: ...|..|...:.:..||:.:|:|..:          :.:.|:..:...
  Fly   218 RQV------ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQ----------ADALGANAKYNG 266

  Fly   262 TLELMISILQHQGIRGLFRGLEAKILQTV-LTAALMFM 298
            .::..:...:::|.:..||||.:.:::.. :.||..|:
  Fly   267 FIDCAMKGFRNEGPQYFFRGLNSTLIRAFPMNAACFFV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 21/82 (26%)
Mito_carr 105..202 CDD:278578 28/99 (28%)
Mito_carr 214..303 CDD:278578 15/86 (17%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 22/88 (25%)
PTZ00169 41..295 CDD:240302 63/279 (23%)
Mito_carr 128..218 CDD:278578 27/95 (28%)
Mito_carr 221..304 CDD:278578 15/92 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.