DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and CG9582

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:306 Identity:77/306 - (25%)
Similarity:129/306 - (42%) Gaps:58/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VSGAAGGCIAMSTFYPLDTVRSRLQLEEA----GDVRST--RQVIKEIVLGEGFQSLYRGLGPVL 78
            ::|...|.|.:..|:|||.|::|:|::.|    |:|..|  ...|.:|...||..||::|:.|  
  Fly    18 LAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVP-- 80

  Fly    79 QSLCI---SNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMR 140
             .:|:   .....|..:.:||.....|:| |.:.|...:.||:|.|:......||.||....:..
  Fly    81 -PICVETPKRGGKFLMYESLKPYFQFGAP-QPTPLTHAMSGSMAAILESFLVNPFEVVKITQQAH 143

  Fly   141 NVAGTSDEVNKHYKNLLEGLKYVAEKE--GIAGLWSGTIPSLMLVSNPALQ---FMMYEMLK--- 197
            .        .|..|. |..:||:.:.:  ||.||:.|.  :.::..|....   |..|..||   
  Fly   144 R--------GKRLKT-LSVVKYIIKHDGYGIKGLYRGI--TALVARNAVFHFGFFGFYNALKDIV 197

  Fly   198 -------RNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGS 255
                   .||:|..          .|..:|.:.|.|::..|.:.:.:.:        .|....|.
  Fly   198 PSPEDKTYNILRKV----------IIAGLASSLACVMSVTLDMAKCRIQ--------GPQPVKGE 244

  Fly   256 TPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYE 301
            . :.:.|:..:.|..:.:|.|.||:||.|.||:.....|::.:.||
  Fly   245 V-KYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/84 (29%)
Mito_carr 105..202 CDD:278578 27/111 (24%)
Mito_carr 214..303 CDD:278578 21/88 (24%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 77/306 (25%)
Mito_carr 17..104 CDD:278578 26/88 (30%)
Mito_carr 109..196 CDD:278578 25/97 (26%)
Mito_carr 216..295 CDD:278578 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.