DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and MME1

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:296 Identity:64/296 - (21%)
Similarity:115/296 - (38%) Gaps:37/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VSGAAGGCIAMSTFYPLDTVRSRLQ---LEEAGDVRSTRQVI---KEIVLGEGFQSLYRGLGPVL 78
            ::|..||...:...:||||::.|||   ....|.....:.||   ......|||:..|||:...|
  Fly    19 IAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAPL 83

  Fly    79 QSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVA 143
            ..:.....|.|..:.|.|.:.......:.:..:....|::||:.:.|.|.|...:...|:.:.|:
  Fly    84 VGVTPIYAVDFAVYAAGKRLFQTD
DHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVS 148

  Fly   144 -------GTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPALQFMMYEMLKRNI- 200
                   ||.|...|.|:           :.||..|:.||...::..|.....|:.||.|:... 
  Fly   149 NGPLLYNGTIDTAAKLYR-----------QGGIRSLFKGTCACILRDSPTGFYFVTYEFLQELAR 202

  Fly   201 MRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLEL 265
            .:...|::.:.|....|..|......|..|..:::::.:            ||...........:
  Fly   203 KKS
ANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQ------------SAPEGTYKHGIRSV 255

  Fly   266 MISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYE 301
            ..:::..:|.:.||||:...:|:...:.|.:|...|
  Fly   256 FRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 23/81 (28%)
Mito_carr 105..202 CDD:278578 23/104 (22%)
Mito_carr 214..303 CDD:278578 15/88 (17%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 24/87 (28%)
Mito_carr 111..205 CDD:278578 23/104 (22%)
Mito_carr 208..297 CDD:278578 17/96 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.