DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and Ucp4C

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:324 Identity:71/324 - (21%)
Similarity:142/324 - (43%) Gaps:45/324 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSKLSQVLSYQN-FVHAVSGAAGGCIAMSTFYPLDTVRSRLQLE-----EAGDVRST-RQVIKEI 61
            |:.::..|:.:| |...|:...|..:|.|..:|||..::|:|::     :.|....| |..:..:
  Fly    24 PTNVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNM 88

  Fly    62 VLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASG--------GSPSQHSALK-DLLLGS 117
            :..|||:|||.|    ..::...||:    |::|:.|...        .:......|| .:.||.
  Fly    89 IRVEGFKSLYAG----FSAMVTRNFI----FNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGC 145

  Fly   118 --IAGIINVLTTTPFWVVNTRLR---MRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTI 177
              .||.|......||.:|..|::   .|...|....||    ::::....:..:.|:..:|.|..
  Fly   146 SFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVN----SMVQAFVDIYRRGGLPSMWKGVG 206

  Fly   178 PSLM---LVSNPALQFMMYEMLKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQR 239
            ||.|   |::...:.  .|::.||...|....|.|....|.....|...|:||:.|..:::::..
  Fly   207 PSCMRACLMTTGDVG--SYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMM 269

  Fly   240 HRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
                   ::|...:|.....:::|:.:..:::.:|:..|::||.....:....:.|.:::.|::
  Fly   270 -------NQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/87 (28%)
Mito_carr 105..202 CDD:278578 25/105 (24%)
Mito_carr 214..303 CDD:278578 15/88 (17%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 22/82 (27%)
Mito_carr 137..232 CDD:278578 25/100 (25%)
Mito_carr 237..329 CDD:278578 17/97 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441665
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.