DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and Rim2

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:369 Identity:80/369 - (21%)
Similarity:147/369 - (39%) Gaps:96/369 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VHAVSGAAGGCIAMSTFYPLDTVRSRLQLEEA--------------------------------- 48
            :|.::|.:.|.:......||:.|::|||...|                                 
  Fly    10 IHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLS 74

  Fly    49 -------------GDVR------------------STRQVIKEIVLGEGFQSLYRGLGPVLQSLC 82
                         |.||                  |..|.::.||..||.::|::||||.|..:.
  Fly    75 TTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVA 139

  Fly    83 ISNFVYFYTFHALK-AVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTS 146
            .|..:||.|:...| .:.|.|...:.|.|..::..:.||.::...|.|.|.|.||:::       
  Fly   140 PSRAIYFCTYSQTKNTL
NSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQL------- 197

  Fly   147 DEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPALQFMMYEMLKRNIMR-------FT 204
            |..:|....:.:.::.|..:.|:|..:.|...|...:....:.|::||.:|..::.       .|
  Fly   198 DYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDT 262

  Fly   205 GGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISI 269
            .|....|.|...||::|..|:.:.||.::.:|:.|....:.:|...|              :.::
  Fly   263 KGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQT--------------LHTV 313

  Fly   270 LQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKIAGTVGMLLKR 313
            .:.:|..||:|||..::::.:...|:|...||.:   |.:|.:|
  Fly   314 WKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAV---VYVLTRR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 29/142 (20%)
Mito_carr 105..202 CDD:278578 21/96 (22%)
Mito_carr 214..303 CDD:278578 20/88 (23%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 30/145 (21%)
Mito_carr 163..253 CDD:278578 21/96 (22%)
Mito_carr 268..355 CDD:278578 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442024
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.