DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and Ant2

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:306 Identity:73/306 - (23%)
Similarity:122/306 - (39%) Gaps:51/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQVIKEIV-------LGEGFQSLYRGLGPVLQ 79
            |.....||.:...|::.|:..||::|.....:..|..|.||       ..:||.|.:||      
  Fly    25 GGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRG------ 83

  Fly    80 SLCISNFVYFYTFHAL--------KAVASGGSPS-----QHSALKDLLLGSIAGIINVLTTTPFW 131
              .::|.:.::...||        |:|..||...     :|.| .:|..|..||..::....|..
  Fly    84 --NLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFA-GNLASGGAAGATSLCFVYPLD 145

  Fly   132 VVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLM-LVSNPALQFMMYEM 195
            ...|||    .|......|:.:..|::.|..|.:.:|..||:.|.|.|:. :|...|..|..|:.
  Fly   146 FARTRL----AADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDT 206

  Fly   196 LKRNIMRFTGGEMGSLSFFFIGAIAKAFATV---LTYPLQLVQTKQRHRSKESDSKPSTSAGSTP 257
            .:..:     ....|..|:...|||:...||   .:||.   .|.:|....:|..|.|...    
  Fly   207 CRDFL-----PNPKSTPFYVSWAIAQVVTTVAGIASYPF---DTVRRRMMMQSGLKKSEMV---- 259

  Fly   258 RTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
             .::|....:.|.:.:||...|:|..:.|::.. ..||:...|:::
  Fly   260 -YKNTAHCWLVIAKQEGIGAFFKGALSNIIRGT-GGALVLALYDEM 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 20/88 (23%)
Mito_carr 105..202 CDD:278578 25/102 (25%)
Mito_carr 214..303 CDD:278578 22/91 (24%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 73/306 (24%)
Mito_carr 17..111 CDD:278578 22/93 (24%)
Mito_carr 119..215 CDD:278578 25/105 (24%)
Mito_carr 218..307 CDD:278578 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.