DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and sesB

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:184 Identity:45/184 - (24%)
Similarity:84/184 - (45%) Gaps:13/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SGAAGGCIAMSTFYPLDTVRSRLQLE--EAGDVRST--RQVIKEIVLGEGFQSLYRGLGPVLQSL 81
            ||.|.|..::...||||..|:||..:  :.|....|  ...:.:|...:|...||||.|..:|.:
  Fly   134 SGGAAGATSLCFVYPLDFARTRLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGI 198

  Fly    82 CISNFVYFYTFHALKAVASG--GSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAG 144
            .|....||..:...:.:...  .:|...|.....::.::|||::.    ||..|..|:.|::...
  Fly   199 IIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGIVSY----PFDTVRRRMMMQSGRK 259

  Fly   145 TSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPALQFMMYEMLKR 198
            .::.:   |||.|.....:|::||....:.|...:::..:..|...::|:.:|:
  Fly   260 ATEVI---YKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/78 (31%)
Mito_carr 105..202 CDD:278578 20/94 (21%)
Mito_carr 214..303 CDD:278578
sesBNP_727448.1 Mito_carr 19..116 CDD:278578
PTZ00169 23..312 CDD:240302 45/184 (24%)
Mito_carr 124..220 CDD:278578 24/85 (28%)
Mito_carr 223..312 CDD:278578 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.