DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and CG1628

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:323 Identity:74/323 - (22%)
Similarity:123/323 - (38%) Gaps:74/323 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NFVHA----VSGAAGGCIAMSTFYPLDTVRSRLQ-LEEAGDVRSTRQVIKEIVLGEG-FQSLYRG 73
            |||..    ::|:.||...:....|||||:.:|| ..||  .|............:| .:.||.|
  Fly   165 NFVEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEA--YRGMLDCFLSTYRKDGVLRGLYAG 227

  Fly    74 LGPVLQSLCISNFVYFYTFHALKAVASGG------------SPSQHSALKDLLLGSIAGIINVLT 126
            ..|.:.:....|.|.|        .|.||            :....:.:::...||:|...:.||
  Fly   228 SVPAVFANVAENSVLF--------AAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLT 284

  Fly   127 TTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEG------------LKYVAEKEGIAGLWSGTIPS 179
            ..|..::..:|          :..:..||.:|.            .:|:...|||.|.:.| :.|
  Fly   285 LCPTELIKCKL----------QALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRG-LSS 338

  Fly   180 LMLVSNPALQFMM------YEMLKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQ 238
            ..|...|...|..      .|:|:|:..  :..::|.|.....|||........|:|..::  |.
  Fly   339 TFLREMPGYFFFFGSYEGTRELLRRDDQ--SKDDIGPLRTMIAGAIGGVCLWTSTFPADVI--KS 399

  Fly   239 RHRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYE 301
            |.:.|..:             ||...:...|::.:|:..|:|||...:|:|:...|.:|:.||
  Fly   400 RIQVKNLN-------------ESMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/86 (28%)
Mito_carr 105..202 CDD:278578 23/114 (20%)
Mito_carr 214..303 CDD:278578 22/88 (25%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 74/323 (23%)
Mito_carr 170..252 CDD:278578 24/91 (26%)
Mito_carr 263..364 CDD:278578 22/111 (20%)
Mito_carr 369..455 CDD:278578 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.