DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and Slc25a36

DIOPT Version :9

Sequence 1:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_006510933.1 Gene:Slc25a36 / 192287 MGIID:1924909 Length:350 Species:Mus musculus


Alignment Length:318 Identity:75/318 - (23%)
Similarity:130/318 - (40%) Gaps:67/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GGCIAMSTFYPLDTVRSRLQLEE-------------AGDVRSTRQVI--------KEIVLGEGFQ 68
            ||.:......||:.|::|||...             ||  .|..:|:        |.|:..||.:
Mouse    55 GGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAG--ASVNRVVSPGPLHCLKAILEKEGPR 117

  Fly    69 SLYRGLGPVLQSLCISNFVYFYTFHALKAVASG----GSPSQHSALKDLLLGSIAGIINVLTTTP 129
            ||:|||||.|..:..|..:||..:...|...:|    .|...|.|     ..::||...:..|.|
Mouse   118 SLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNG
VFDPDSTQVHMA-----SAAMAGFTAITATNP 177

  Fly   130 FWVVNTRLRMRNVAGTSDEVNKHYKNL--LEGLKYVAEKEGIAGLWSGTIPSLMLVSNPALQFMM 192
            .|::.|||::       |...:..|.:  .|.::.|.:.:|:.|.:.|...|...:|...:.|::
Mouse   178 IWLIKTRLQL-------DARTRGEKQMGAFECVRKVYQTDGLRGFYRGMSASYAGISETVIHFVI 235

  Fly   193 YEMLKRNIMRFTGGEM------------GSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKES 245
            ||.:|:.::......|            ..:......|.:|..||.:.||.::|:|:.|...   
Mouse   236 YESIKQKLLE
CKTASMMETDEESVKEASDFVRMMLAAATSKTCATTIAYPHEVVRTRLREEG--- 297

  Fly   246 DSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303
                       .:..|..:.:..|:|.:|...|:|||...:::.:...|:|...||.:
Mouse   298 -----------TKYRSFFQTLSLIVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 27/91 (30%)
Mito_carr 105..202 CDD:278578 23/98 (23%)
Mito_carr 214..303 CDD:278578 21/88 (24%)
Slc25a36XP_006510933.1 Mito_carr 54..150 CDD:365909 28/96 (29%)
Mito_carr 156..245 CDD:365909 24/100 (24%)
Mito_carr 265..350 CDD:365909 21/94 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53601
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.