DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PMP34 and LOC1274647

DIOPT Version :10

Sequence 1:NP_728982.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_313798.6 Gene:LOC1274647 / 1274647 VectorBaseID:AGAMI1_011134 Length:405 Species:Anopheles gambiae


Alignment Length:137 Identity:29/137 - (21%)
Similarity:46/137 - (33%) Gaps:34/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGL------- 172
            ||:...|..|:..|.|:..|...|:....||.|...|  :.|...:..|.::.|..|.       
Mosquito    98 LGAPTQIAGVMIDTAFFTGNYVPRVSIQGGTLDATMK--RMLQTSIPRVTDEGGNIGTGRTTEEL 160

  Fly   173 ----------WSGTIPSLMLVSNPALQFMMYEMLKRNIMRFTGGEMG------SLSFFFIGAIA- 220
                      |...:|...|.:.       ||..:|:......|:..      .::.|..|.|| 
Mosquito   161 GMVELIGTDQWDVLVPRTELQAG-------YEPTRRHYFTVAKGKQSLIVNHLRVNMFPDGGIAR 218

  Fly   221 -KAFATV 226
             :.:.||
Mosquito   219 LRVYGTV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PMP34NP_728982.1 Mito_carr 15..96 CDD:395101
Mito_carr 105..202 CDD:395101 22/103 (21%)
Mito_carr 214..303 CDD:395101 6/15 (40%)
LOC1274647XP_313798.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.