DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and MATN4

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001380459.1 Gene:MATN4 / 8785 HGNCID:6910 Length:581 Species:Homo sapiens


Alignment Length:218 Identity:41/218 - (18%)
Similarity:70/218 - (32%) Gaps:80/218 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 RPFQVDMLHAVTANFL-GDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDENKFDM-- 263
            |||:.:.:.......| |.|:          ||.|:.| |:::....:..|..::....:.||  
Human    46 RPFEFETMRQFLMGLLRGLNV----------GPNATRV-GVIQYSSQVQSVFPLRAFSRREDMER 99

  Fly   264 LVRNCV---------------------AHDGKRAPIQLVDQNGCVV---RPK-------IMSKFQ 297
            .:|:.|                     ..:|.|.|.:.|.:...:|   ||:       ..::.:
Human   100 AIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGARPPEERVPRVAVIVTDGRPQDRVAEVAAQARAR 164

  Fly   298 KIKNFGPSAS---------------------VVSFAYFQAFKFPDSMNVHFQ---CVIQVC---R 335
            .|:.:.....                     |.||...|.|      .:.||   |.|.:|   .
Human   165 GIEIYAVGVQRADVGSLRAMASPPLDEHVFLVESFDLIQEF------GLQFQSRLCAIDLCAEGT 223

  Fly   336 YNCPEPKCGPGLPGGEYGLPQIG 358
            :.| |..| ...||..:...|:|
Human   224 HGC-EHHC-VNSPGSYFCHCQVG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 37/203 (18%)
PHA03378 <339..494 CDD:223065 6/20 (30%)
MATN4NP_001380459.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.