Sequence 1: | NP_647890.2 | Gene: | dyl / 38531 | FlyBaseID: | FBgn0066365 | Length: | 611 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001380459.1 | Gene: | MATN4 / 8785 | HGNCID: | 6910 | Length: | 581 | Species: | Homo sapiens |
Alignment Length: | 218 | Identity: | 41/218 - (18%) |
---|---|---|---|
Similarity: | 70/218 - (32%) | Gaps: | 80/218 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 202 RPFQVDMLHAVTANFL-GDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDENKFDM-- 263
Fly 264 LVRNCV---------------------AHDGKRAPIQLVDQNGCVV---RPK-------IMSKFQ 297
Fly 298 KIKNFGPSAS---------------------VVSFAYFQAFKFPDSMNVHFQ---CVIQVC---R 335
Fly 336 YNCPEPKCGPGLPGGEYGLPQIG 358 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dyl | NP_647890.2 | ZP | 90..345 | CDD:214579 | 37/203 (18%) |
PHA03378 | <339..494 | CDD:223065 | 6/20 (30%) | ||
MATN4 | NP_001380459.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X161 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |