DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and COL21A1

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001305680.1 Gene:COL21A1 / 81578 HGNCID:17025 Length:957 Species:Homo sapiens


Alignment Length:192 Identity:46/192 - (23%)
Similarity:65/192 - (33%) Gaps:61/192 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 PGLPG-----GEYGLPQIGAN----GLSEEYGPPEAYERNDFALGGPGVLPPAAYP-DPRHPASD 399
            ||.||     ||.|:|....|    |...|.||| ..:....|.|.||::.....| .|..|.|.
Human   592 PGAPGQDGTRGEPGIPGFPGNRGLMGQKGEIGPP-GQQGKKGAPGMPGLMGSNGSPGQPGTPGSK 655

  Fly   400 ATGAYSENQPDVVPSPQAQTSAAVPTADSGTVSGPASSQSP-QPQPTGSNELGLP---------- 453
            .    |:.:|.:...|.|          ||....|.::.|| :|     ..:|||          
Human   656 G----SKGEPGIQGMPGA----------SGLKGEPGATGSPGEP-----GYMGLPGIQGKKGDKG 701

  Fly   454 ---------------PPPLPGQ---SGQYSTVKRKDDLSAGGNLVSLGGRPRSVEGLDDLRG 497
                           ...:|||   .|.:.....:.:....|...::|.:..|  |:|.|.|
Human   702 NQGEKGIQGQKGENGRQGIPGQQGIQGHHGAKGERGEKGEPGVRGAIGSKGES--GVDGLMG 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 46/192 (24%)
PHA03378 <339..494 CDD:223065 43/187 (23%)
COL21A1NP_001305680.1 vWFA 34..254 CDD:320736
LamG 230..412 CDD:328935
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..786 46/192 (24%)
Glutenin_hmw <454..>764 CDD:281191 46/192 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 825..938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.