DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and Vit

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_083089.1 Gene:Vit / 74199 MGIID:1921449 Length:650 Species:Mus musculus


Alignment Length:277 Identity:56/277 - (20%)
Similarity:88/277 - (31%) Gaps:72/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 CRYNCPEPK---------------CGPGLPGGEYGLPQIGANGLSEEYGPPEAYE---------- 373
            |...|.:||               ||..:..|.  |...|...|..:......|:          
Mouse    62 CPAGCQDPKYHVYGTGVYASYSSVCGAAIHSGV--LDNSGGKILVRKVAGQSGYKGSYSNGVQSL 124

  Fly   374 -----RNDFALGGPGVLPPAAYPD---------PRHPASDATGAYSEN-------QPDVVPSPQA 417
                 |..|.:.........|||.         ....|.:.|.||.:.       ||..:...||
Mouse   125 SLPRWRESFIVAESKPQKGVAYPSTLTYSSSKTAAAKAGETTKAYEKPSIPGTTIQPVTLTQAQA 189

  Fly   418 QTSAAVPTADSGTVSGPASSQSPQPQPTG--SNEL----GLPPPPLPGQSGQYSTVKRKDDLSAG 476
            ...|.|....:......:.:.||:|||.|  |.|:    |..|.|:...||    ...|::||..
Mouse   190 TPVAEVTHRSTSKPFAASVTNSPRPQPVGHRSQEMEEVDGWKPGPVLLDSG----FVPKEELSTQ 250

  Fly   477 GNLVSLGGRPRSVEGL----DDLRGVRRRRDTMDIVVKPQRIYKRNAQEMTDVN-TSRIIQVVAP 536
            .:.....|.|.....|    |....:.:||      .:.|:.:..:..:..|:. ...::.||..
Mouse   251 SSEPVPQGDPNCKIDLSFLIDGSTSIGKRR------FRIQKQFLADVVQALDIGPAGPLVGVVQY 309

  Fly   537 GD---VNFALNSNASNE 550
            ||   ..|.|.::.:::
Mouse   310 GDNPATQFNLKTHMNSQ 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 5/25 (20%)
PHA03378 <339..494 CDD:223065 43/210 (20%)
VitNP_083089.1 LCCL 44..133 CDD:281766 12/72 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..226 8/27 (30%)
vWFA 265..428 CDD:294047 12/68 (18%)
vWA_collagen 466..626 CDD:238749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.