DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and vit

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_017214391.1 Gene:vit / 497398 ZFINID:ZDB-GENE-050208-114 Length:831 Species:Danio rerio


Alignment Length:264 Identity:56/264 - (21%)
Similarity:79/264 - (29%) Gaps:111/264 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 PASDATGAYSENQPDVVPSPQAQ---------------------------------TSAAVPTAD 427
            |::.|:||||..||   ||.:.|                                 :|.:||...
Zfish   297 PSAPASGAYSRGQP---PSERKQHTPQSNPVFARRDWTHPSYARPDWFSGSRRPTDSSQSVPNTG 358

  Fly   428 ---SGTVSG-PA-----------------------SSQSPQPQPTGSNELGLPPPPLPGQSGQYS 465
               |.|.|| ||                       .|:..:|.|..|:....|....|.:||..|
Zfish   359 YKWSRTSSGDPAVFDPVPDRTEYEHWPHNNQQFSPESEENKPVPETSHTRETPAESNPFESGFTS 423

  Fly   466 TVKRKDDLSAGGNLVSLGGRPRSVEGLDDLR------GVRRRRDTMDIVVKPQR----------- 513
            .|.   |.:|....|...|.|.....:..|.      |.||.:...|.:|:..:           
Zfish   424 RVM---DTTARAPEVPSQGDPNCKVDMAFLMDGSWSIGKRRFKIQKDFLVEVSQALNVGVAGAMM 485

  Fly   514 -IYKRNAQEMTDVN-------------TSRIIQVVAPGDVNFAL-----------NSN---ASNE 550
             |.:.....:|:.:             .|:|:|...|..|..||           |.|   |.|.
Zfish   486 GIIQYGDDPVTEFSLKQFSNSKDLKPAISKIVQKGGPSHVGKALSYINKQFFSDANGNRGGAPNV 550

  Fly   551 TVVI 554
            .||:
Zfish   551 AVVL 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579
PHA03378 <339..494 CDD:223065 35/157 (22%)
vitXP_017214391.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.