DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dyl and matn4

DIOPT Version :9

Sequence 1:	NP_647890.2	Gene:	dyl / 38531	FlyBaseID:	FBgn0066365	Length:	611	Species:	Drosophila melanogaster
Sequence 2:	XP_005155921.1	Gene:	matn4 / 497348	ZFINID:	ZDB-GENE-050208-64	Length:	944	Species:	Danio rerio

Alignment Length:	104	Identity:	21/104 - (20%)
Similarity:	39/104 - (37%)	Gaps:	27/104 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   156 GAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVTFRPFQVDMLHAVTANFLGDN 220
            |.|......|:...||          |.:|.:|...::      |.|.|.:|::|.:......
Zfish    25 GEPKCKSGPVDLVFII----------DGSRSVRPHEFE------TMRKFMIDIIHELDIGLAA-- 71

  Fly   221 LQCWMQIQVGKGPWASEVSGIVKI---GQTMTMVLAIKD 256
                  .::|...::|:|..:..:   .:|..||.||.:
Zfish    72 ------TRIGVVQYSSQVQNVFSLKAFSKTEQMVKAINE 104

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dyl	NP_647890.2	ZP	90..345	CDD:214579	21/104 (20%)
dyl	NP_647890.2	PHA03378	<339..494	CDD:223065
matn4	XP_005155921.1	vWFA	32..251	CDD:294047	19/97 (20%)
		FXa_inhibition	258..293	CDD:291342
		FXa_inhibition	299..334	CDD:291342
		FXa_inhibition	340..375	CDD:291342
		FXa_inhibition	381..416	CDD:291342
		FXa_inhibition	422..457	CDD:291342
		vWFA	<454..497	CDD:294047
		FXa_inhibition	504..539	CDD:291342
		vWFA	<536..579	CDD:294047
		FXa_inhibition	586..621	CDD:291342
		vWFA	<618..661	CDD:294047
		vWFA	<659..702	CDD:294047
		vWFA	711..944	CDD:294047
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910