DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and qsm

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:314 Identity:69/314 - (21%)
Similarity:107/314 - (34%) Gaps:102/314 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QVQCEKTHMRVNI-----EFDRPFYGMIFSKGF--YSDPHCVHLKPGTGHLSATFEIFLN---SC 142
            :|.|.:..|||:|     |........|:.:|.  |.|..|   :|......|.|.:.|:   .|
  Fly    28 KVHCSEDQMRVDIGLPDAESKDQSAPQIYLEGLKGYPDERC---QPQIDGSLAVFRLSLSDFYEC 89

  Fly   143 GMTSSANHNAAGYGAPTPSGSYV-ENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVTFRPFQV 206
            |:|...|.         .:|..| .:.|||:.....:.|     .::|        ..|..|...
  Fly    90 GVTRMVNQ---------LTGKKVYYHKIIIESTSGKEIV-----SVKC--------ITTASPAYN 132

  Fly   207 DMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIVK---------------IGQTMT------- 249
            .|::|.|.:         .......|    .:.|:||               |..::|       
  Fly   133 VMMNATTGS---------SSTSTSSG----GIHGLVKRDVLPAGFQEPEDLEITTSLTKRAPEPR 184

  Fly   250 MVLAIKDDENKF--DMLVRNC------VAHDGKRAPIQLVDQN-----------------GCVVR 289
            :.:.:..|..||  |:.|::.      :..|...||:..:..|                 ||.|.
  Fly   185 LSIGVSQDGQKFTRDLTVKSGTPLTMEINLDEDSAPVYGLGVNYLDVTDTHTSSETLIFKGCTVD 249

  Fly   290 PKIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYNCPEPKC 343
            |.:...|..|     ...::| |.|:|||||||..|.|:..:.||...|...:|
  Fly   250 PYLFENFNTI-----DGDILS-AKFKAFKFPDSSYVQFRATVNVCLDKCLGTQC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 68/312 (22%)
PHA03378 <339..494 CDD:223065 1/5 (20%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 68/312 (22%)
Zona_pellucida <200..300 CDD:278526 27/104 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.