DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and nyo

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_651871.2 Gene:nyo / 43716 FlyBaseID:FBgn0039852 Length:805 Species:Drosophila melanogaster


Alignment Length:296 Identity:73/296 - (24%)
Similarity:116/296 - (39%) Gaps:56/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PLASTNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHC-VHLKPGTGHLSATFEI 137
            |.|:|.:.....::.::|....|...|...:.|.|.:::||  :...| |::   ...|...|.:
  Fly   366 PEAATYELSACYNVSIECRSGEMITKIRTSKLFDGKVYAKG--APKSCAVNV---NNSLEFDFRM 425

  Fly   138 FLN--SCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKAVT 200
            ..|  .|.:..||            .|.|: |.|:||:...:....|....:.|. ||...|.| 
  Fly   426 GYNDLECNVRQSA------------YGRYM-NDIVIQHHDMIVTSSDLGLAVSCQ-YDLTNKTV- 475

  Fly   201 FRPFQVDMLHAVTANFLG------------DNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLA 253
                    |:.|.....|            |:....|:|....|   |::..:.::|..:.:...
  Fly   476 --------LNDVDLGVTGEIESSLSEEITIDSPNVIMKITSRDG---SDMKRMAEVGDPLALRFE 529

  Fly   254 IKDDENKFDMLVRNCVAHDGK-RAPIQLVDQNGCVVRPKIMSKFQKIKNFGPSASVVSFAYFQAF 317
            |.:..:.:::.||..||.||. .|.|.|:|.|||.....||...||:    .....|..:.|.||
  Fly   530 IVEPNSPYEIFVRELVAMDGSDSAEITLIDANGCPTDQYIMGTIQKL----AQNRKVLLSQFDAF 590

  Fly   318 KFPDSMNVHFQCVIQVCRYNCPEPKCGPGLPGGEYG 353
            |||.|..|.|:.::..|     .|:|.|.:...|.|
  Fly   591 KFPSSEVVQFRALVTPC-----IPRCEPVICDSEDG 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 67/270 (25%)
PHA03378 <339..494 CDD:223065 5/15 (33%)
nyoNP_651871.2 PAN_1 121..198 CDD:278453
PAN_AP_HGF 208..286 CDD:238532
PAN_1 295..374 CDD:278453 3/7 (43%)
ZP 382..618 CDD:214579 68/275 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
21.910

Return to query results.
Submit another query.