DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and mey

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001287622.1 Gene:mey / 43715 FlyBaseID:FBgn0039851 Length:774 Species:Drosophila melanogaster


Alignment Length:301 Identity:78/301 - (25%)
Similarity:123/301 - (40%) Gaps:54/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 STGATNDVSEEAWPL--ASTNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHC-V 122
            |.....|:||....:  |:|.:.....::.:.|....|...|...:.|.|.:::||  :...| |
  Fly   376 SRATLTDLSEPYLSIEEAATYEQSACYNVSIDCRSGEMITKIRTSKLFDGKVYAKG--APKSCAV 438

  Fly   123 HLKPGTGHLSATFEIFLN----SCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQ 183
            ::     :.|..|::.:.    .|.:..||            .|.|: |.|:||:...:....|.
  Fly   439 NV-----NNSLEFDLKMRYNDLECNVRQSA------------YGRYM-NDIVIQHHDMIVTSSDL 485

  Fly   184 ARKLRCTWYDFYEKAVTFRPFQVDMLHAVTA--------NFLGDNLQCWMQIQVGKGPWASEVSG 240
            ...:.|. ||...|.|.   ..||:  .||.        ..:.|:....|:|....|   |::..
  Fly   486 GLAVSCQ-YDLTNKTVV---NNVDL--GVTGEIESTLSEEIIVDSPNVIMKITARDG---SDMKR 541

  Fly   241 IVKIGQTMTMVLAIKDDENKFDMLVRNCVAHDG-KRAPIQLVDQNGCVVRPKIMSKFQKIKNFGP 304
            |.::|..:.:...|.|..:.:::.||..||.|| ..|.|.|:|.|||.....|||..||:.|   
  Fly   542 IAEVGDPLALRFEIVDANSPYEIFVRELVAMDGTDSAEITLIDANGCPTDQYIMSAMQKLAN--- 603

  Fly   305 SASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYNCPEPKCGP 345
             ...|..:.|.|||||.|..|.|:.::..|     .|:|.|
  Fly   604 -NRKVLLSQFDAFKFPSSELVQFRALVTPC-----IPRCEP 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 71/268 (26%)
PHA03378 <339..494 CDD:223065 3/7 (43%)
meyNP_001287622.1 PAN_1 146..223 CDD:278453
PAN_AP_HGF 233..311 CDD:238532
PAN_AP_HGF 319..>380 CDD:238532 1/3 (33%)
ZP 408..642 CDD:214579 72/269 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
21.910

Return to query results.
Submit another query.