DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and neo

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_651733.1 Gene:neo / 43523 FlyBaseID:FBgn0039704 Length:744 Species:Drosophila melanogaster


Alignment Length:288 Identity:73/288 - (25%)
Similarity:125/288 - (43%) Gaps:37/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PLASTNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHC-VHLKPGTGHLSATFEI 137
            |.|||.:.....::.::|....|...|...:.|.|.:::||  |...| |.:|.     :..||:
  Fly   365 PEASTYELTSCYNVTIECGGGDMLARIRTSKLFNGKVYAKG--SPKSCSVDVKS-----ALDFEL 422

  Fly   138 FLN----SCGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEKA 198
            .:|    .|.:..|.            :|.|| |.||||:...:....|....|.|. ||...|:
  Fly   423 RMNYHDLECNVRQST------------AGRYV-NDIIIQHHDMIVTSSDLGLALACQ-YDLTNKS 473

  Fly   199 VT---FRPFQVDMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIVKIGQTMTMVLAIKDDENK 260
            |:   ....:.|::.|::...:.::....|:|....|   |::....::|..:.:...|.|:::.
  Fly   474 VSNGVDLDVRGDIMPALSEEVIVESPNVIMRITSRDG---SDMMRSAEVGDPLALKFEIVDEQSP 535

  Fly   261 FDMLVRNCVAHDG-KRAPIQLVDQNGCVVRPKIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMN 324
            :::.:|..||.|| ..:.|.|:|.|||.....||....|    |..:..:..:.|.|||||.|..
  Fly   536 YEIFIRELVAMDGVDNSEITLIDSNGCPTDHFIMGPIYK----GSVSGKMLLSNFDAFKFPSSEV 596

  Fly   325 VHFQCVIQVCRYNCPEPKCGPGLPGGEY 352
            |.|:.::..|..:|...:|......||:
  Fly   597 VQFRALVTPCMPSCEPVQCEQEDTSGEF 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 67/263 (25%)
PHA03378 <339..494 CDD:223065 3/14 (21%)
neoNP_651733.1 PAN_1 120..197 CDD:278453
PAN_AP_HGF 211..285 CDD:238532
PAN_1 294..373 CDD:278453 4/7 (57%)
ZP 381..615 CDD:214579 66/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
21.910

Return to query results.
Submit another query.