DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and CG17111

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster


Alignment Length:401 Identity:80/401 - (19%)
Similarity:128/401 - (31%) Gaps:109/401 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 QIKHLQVQ--CEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATF----EIFLNS 141
            ::|.|.|:  |.:..|.:.......|.|.|::.....|  |:....|.|.:..|.    |:..|.
  Fly   344 RVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMHSKD--CLARGSGNGSVLLTLQIGSEVKENR 406

  Fly   142 CG------MTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEK-AV 199
            ||      ||.....            :::...::||.:|.||...|:..|:.|...:.... .|
  Fly   407 CGILRAYEMTQEYQR------------TFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGV 459

  Fly   200 TFRPFQVDMLHAV-TANFLGDNLQCWMQI-----------QVGKGPWAS-----------EVSGI 241
            :.|...||....| :|..|..:|:....:           ..|..|..|           ..:..
  Fly   460 SVRDSSVDSSEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQILDLSHQHETND 524

  Fly   242 VKIGQTMTMVLAIKDDENKF------------DMLVRNCVAHDGKRAP----IQLVDQNGCVVRP 290
            |:|||.:.:.:..:....:.            |....:.||   |.|.    :.|:|:.||   |
  Fly   525 VQIGQNLELQIVAEYSPQQLAEHMELQLAPLPDFRATSLVA---KTADNENFVLLIDERGC---P 583

  Fly   291 KIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYNCPEPKC------------ 343
            ...|.|..::....::..:..|.|.||||..:.||.|...|:.|...|....|            
  Fly   584 TDASVFPALERVHTASRSMLRARFHAFKFSGTANVSFDVKIRFCVERCSPSNCISSSWQRRRRQA 648

  Fly   344 ------------------------GPGLPGGEYGLPQIGANGLSEEYGPPEAYERNDFALGGPGV 384
                                    .|..........::..|.....:||.:: ..|.:..|..||
  Fly   649 DQPDRRPEDLRVQNPVYISTVVDVAPQPDNFTRSQEELPLNYNIRVHGPDQS-NTNSYLYGERGV 712

  Fly   385 LPPAAYPDPRH 395
            |..|...||.|
  Fly   713 LLIAGIDDPLH 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 64/342 (19%)
PHA03378 <339..494 CDD:223065 14/93 (15%)
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532 80/401 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.