DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and MATN2

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_002371.3 Gene:MATN2 / 4147 HGNCID:6908 Length:956 Species:Homo sapiens


Alignment Length:182 Identity:38/182 - (20%)
Similarity:59/182 - (32%) Gaps:59/182 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLNTQHLSVHGDASHIESAALPLEHRAGYGPPAPIYGAPQGPLSTGATNDV------------SE 70
            |.|...|......|.:|.|...:.|                 ||||....:            :|
Human   105 VKNEFSLKTFKRKSEVERAVKRMRH-----------------LSTGTMTGLAIQYALNIAFSEAE 152

  Fly    71 EAWPLAS---------TNDSPQ--IKHLQVQCEKTHMRV------NIEFDRPFYGMIFSKGFYSD 118
            .|.||..         |:..||  :..:..:...|.:.:      .::|:.       .|...|:
Human   153 GARPLRENVPRVIMIVTDGRPQDSVAEVAAKARDTGILIFAIGVGQVDFNT-------LKSIGSE 210

  Fly   119 PHCVHLKPGTGH-----LSATFEIFLNSCGMTSSANHNAAGYGAPTPSGSYV 165
            ||..|:......     |::.|:..|.:..|.|:..||.|.:....| ||||
Human   211 PHEDHVFLVANFSQIETLTSVFQKKLCTAHMCSTLEHNCAHFCINIP-GSYV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 20/87 (23%)
PHA03378 <339..494 CDD:223065
MATN2NP_002371.3 vWA_Matrilin 54..276 CDD:238752 38/182 (21%)
FXa_inhibition 283..318 CDD:291342
FXa_inhibition 324..359 CDD:291342
FXa_inhibition 365..400 CDD:291342
FXa_inhibition 406..441 CDD:291342
vWFA <438..481 CDD:294047
FXa_inhibition 488..523 CDD:291342
vWFA <520..563 CDD:294047
vWFA <561..603 CDD:294047
vWFA <602..644 CDD:294047
vWA_Matrilin 652..892 CDD:238752
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 840..863
Matrilin_ccoil 911..953 CDD:287378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.