DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and CG12814

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster


Alignment Length:350 Identity:71/350 - (20%)
Similarity:120/350 - (34%) Gaps:82/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PLSTGATNDVSEEAWPLASTNDSPQIKHLQVQCEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVH 123
            |:.......|:.:..|.:.:..:|   |:...|:...|.:.::....:.|.:..:. |..|.|:.
  Fly    17 PVLLFLAGQVTTQEPPASPSEFAP---HVTATCKAGTMNIKVKMSSGYTGAVHVRD-YRTPGCMA 77

  Fly   124 LKPGTGHLSATFEIFLNS-----CGMTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQ 183
            :..|:..::.:..::...     ||:..|           ..|||.......||....|.:..:.
  Fly    78 MGDGSDQVAFSLNLWAKQGASDYCGILVS-----------NVSGSNRTEERSIQLAVRVHKTLEL 131

  Fly   184 ARKLRCTWYDFYEKAVTFRPFQVDMLHAVTANFLGDNLQCWMQIQVGKGPWASEVSGIVKI---- 244
            |.                     |..:.:|.               ||..:|.:.:..|.:    
  Fly   132 AD---------------------DKFYVITC---------------GKSGYARDDNAHVVLKFLE 160

  Fly   245 ----------GQTMTMVLAIKDDENKFDMLVRNCVAHDGKRAPIQLVDQNGCVVRPKIMSKFQKI 299
                      |....:........:.:.:.|.||.|.|.|....:|.|.:||....||:|:|...
  Fly   161 NDHRVRETVYGHEYKIRAEFSKPNDTYGLRVGNCFAFDKKNRTQKLTDDSGCPYDSKIISRFVPT 225

  Fly   300 KNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYNCPE-PKCGPGLPGGEYGLPQIGANGLS 363
            .:...:.:|:|    ..||||:...||.||.:..|...|.| ..|......| :|.   |.|| .
  Fly   226 ADGRAAEAVLS----SMFKFPEGSEVHLQCDVIQCYGRCVEIDDCNDVALAG-FGK---GTNG-P 281

  Fly   364 EEYGPPEAYERNDFALGGPGVLPPA 388
            .::||.|  |.:..|.....||.||
  Fly   282 RKFGPNE--EGSSLAGTTVFVLDPA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 52/274 (19%)
PHA03378 <339..494 CDD:223065 15/50 (30%)
CG12814NP_001262454.1 ZP 45..256 CDD:214579 48/262 (18%)
Zona_pellucida <181..256 CDD:278526 24/78 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.