DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and matn1

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001093210.1 Gene:matn1 / 403023 ZFINID:ZDB-GENE-050307-3 Length:489 Species:Danio rerio


Alignment Length:251 Identity:46/251 - (18%)
Similarity:78/251 - (31%) Gaps:77/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 PG------VLPPAAYPDPRHPASDATGAYSENQPDVV----------PSPQAQTSAAVPTADSGT 430
            ||      :|...|..|.|..|:.|.|..:....|||          ||...|....:.....|.
Zfish     4 PGFVMLLCILGAQATVDLRQAAAMAAGLCNTKPTDVVFIVDSSRSVRPSEFEQVKVFLAKVIDGL 68

  Fly   431 VSGPASSQ------------------------------SPQPQPTGSNELGLPPPPLPGQSGQYS 465
            ..||.:::                              ..:|..||:         :.|.:.|::
Zfish    69 SVGPDATRVGVVNYASRVKNEVSLKSHKTKAALVKAVSKIEPLSTGT---------MTGLAIQFA 124

  Fly   466 T---------VKRKDDLSAGGNLVSLGGRPRSVEGLDDLRGV--RRRRDTMDI-VVKPQRIYKRN 518
            .         .::..|:|....:|: .|||:     |::|.:  |.|...::| .:...|:....
Zfish   125 MNVAFSEAEGGRKSPDISKVAIIVT-DGRPQ-----DNIRDIAARAREAGIEIFAIGVGRVDMTT 183

  Fly   519 AQEMTDVNTSRIIQVVAPGDVNFALNSNASNETVVIQSARSA----DAETICMSVP 570
            .::|........:..|....:...|..........:.|...|    |.|.||:|.|
Zfish   184 LRQMASEPLEDHVDYVESYSLIEKLTKKFQEAFCAVVSDLCATGDHDCEHICISTP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579
PHA03378 <339..494 CDD:223065 29/166 (17%)
matn1NP_001093210.1 vWA_Matrilin 35..258 CDD:238752 37/220 (17%)
vWA_Matrilin 265..489 CDD:238752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.