DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and Col6a6

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_038938536.1 Gene:Col6a6 / 315979 RGDID:1309172 Length:2264 Species:Rattus norvegicus


Alignment Length:268 Identity:60/268 - (22%)
Similarity:81/268 - (30%) Gaps:72/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 PKCGPGLPGGEYGLPQIGANGLSEEYG----PPEAYERNDF-ALGGPGVL-------PPAAYPDP 393
            ||...||.|.|..:.:.|.:||:.|.|    |....||.|. :.|.||..       |.....||
  Rat  1446 PKGARGLSGEEGEVGEDGLDGLNGEQGDSGIPGRRGERGDAGSQGSPGKRGASGDRGPKGLRGDP 1510

  Fly   394 RHPASD-----------------------ATGAYSENQPDVV------PSPQAQTSAAVPTADSG 429
            ..|..|                       :.|.....:..||      ..||.......|....|
  Rat  1511 GTPGRDNSIQGPKGLKGDPGRQGRRGWPGSPGTPGSRRKMVVHGRRGHTGPQGNPGITGPDGLEG 1575

  Fly   430 T-----VSGPASSQSPQPQPTGSNELGLPPPPLP----GQSGQYSTVKRKDDLSAGGNLVSLGGR 485
            :     ..||......:.:..|....|...||.|    |..|.:.:...|.:   .|:|...|..
  Rat  1576 SPGLKGPQGPRGEVGEKGEKGGFGMKGPQGPPGPKGRAGNQGHWGSQGSKGE---PGDLGEKGAA 1637

  Fly   486 ----PRSVEGLDDLRGVRR--RRDTMDIVVKPQRIYKRNAQEMTDVNTSRIIQVVAPGDVNFALN 544
                ||.::|.|...|...  |:.|     |.|..:...:....|:..        |||...|..
  Rat  1638 GFPGPRGLQGDDGSPGYGSIGRKGT-----KGQEGFPGESGPKGDIGD--------PGDPGEAGP 1689

  Fly   545 SNASNETV 552
            ..|..:||
  Rat  1690 KGARGKTV 1697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579 2/3 (67%)
PHA03378 <339..494 CDD:223065 46/206 (22%)
Col6a6XP_038938536.1 vWFA 25..179 CDD:412136
vWFA 227..392 CDD:412136
VWA 435..604 CDD:395045
VWA 621..789 CDD:395045
VWA 808..980 CDD:395045
VWA 999..1166 CDD:395045
VWA 1186..1344 CDD:214621
Collagen 1394..1450 CDD:396114 2/3 (67%)
Collagen 1481..1547 CDD:396114 12/65 (18%)
Collagen 1521..1589 CDD:396114 9/67 (13%)
Collagen 1638..1695 CDD:396114 15/69 (22%)
VWA 1757..1921 CDD:395045
vWFA_subfamily_ECM 1962..2140 CDD:238727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.