DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dyl and Matn3

DIOPT Version :9

Sequence 1:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001382499.1 Gene:Matn3 / 313954 RGDID:1305085 Length:481 Species:Rattus norvegicus


Alignment Length:154 Identity:40/154 - (25%)
Similarity:59/154 - (38%) Gaps:31/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 LPPPPLPGQSGQYSTVKRKDDLSAGGNLVSLGGRPRSVEGLDDLRGVR-------RRRDTMDIV- 508
            ||||..||:..: ::|:|......||:......|..|...  ...|||       |..|.:.|: 
  Rat    23 LPPPAAPGRLTR-ASVRRLGTRVPGGSPGHFSARATSTRA--PYSGVRGSGVCKSRPLDLVFIID 84

  Fly   509 ----VKPQRIYKRNAQEMTDVNT--SRIIQVVAPG--DVNFALNSNASNETVVIQ----SARSAD 561
                |:|        .|.|.|.|  ||||..:..|  |...|:.:.||...:..|    |.:.|.
  Rat    85 SSRSVRP--------LEFTKVKTFVSRIIDTLDIGATDTRVAVVNYASTVKIEFQLNTYSNKQAL 141

  Fly   562 AETICMSVPSFVGGLVMLLLVLAV 585
            .:.:....|...|.:..|.:..|:
  Rat   142 KQAVARITPLSTGTMSGLAIQTAM 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dylNP_647890.2 ZP 90..345 CDD:214579
PHA03378 <339..494 CDD:223065 12/41 (29%)
Matn3NP_001382499.1 vWFA 75..298 CDD:412136 25/99 (25%)
FXa_inhibition 305..341 CDD:405372
FXa_inhibition 347..383 CDD:405372
FXa_inhibition 389..425 CDD:405372
Matrilin_ccoil 438..478 CDD:402147
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.